There is no doubt that handguns have been a part of American culture for centuries. They are often seen as the most deadly weapon in one’s arsenal, and they are used to protect both individuals and groups from harm. In Sturgis, Michigan, firearms play an important role in the community by providing law enforcement with the ability to protect their citizens and enforce laws. The history of rifles and shotguns in this small town dates back to 1875. Throughout the years, gun parts have been a vital part of American society. Herein we will explore some of the more common firearm parts and how they were used in Sturgis over time. In 1875, rifle barrels were introduced into America. This new technology allowed for greater accuracy when shooting at close range. This change was not only beneficial to military purposes but also helped increase production at arsenals across the country (Fowler). Shotguns followed suit soon after, allowing homeowners and farmers alike to take on larger game with ease (Fowler). Shotguns became popular due to their low recoil which made them ideal for self-defense or hunting large animals (Gray). Rifle barrels continued being produced until well into World War II; however, shotguns took on a much larger role during this time as ammunition prices plummeted (Doyle). As ammo prices increased again throughout the late twentieth century, rifle barrels began becoming less common in favor of shotgun barrels due to their higher cost per shot (Smithers). However, shotgun barrel production still remains strong thanks to its versatility and popularity among shooters around the world (Wang et al.).
Gun parts are essential for any firearm. There are different types of parts, depending on the type of firearm. The most common part is the gun’s barrel, which is what shoots the rounds that make up a firearms cartridge. Other important parts include the frame, which holds and supports the barrel and other components; magazine well or feed lip; breechblock; striker/firer assembly; stock or grip safety; and bolt carrier group (BCG). The barrels of handguns and rifle rifles have several chambers that hold rounds in sequence before they can be fired. The chamber where the round will go is called the primer area. The BCG is responsible for firing those rounds and prevents them from going astray by feeding them into one of these larger chambers incorrectly. It also helps to stabilize the firearm when it's in use, since it keeps powder gases inside the gun instead of outside like with an air-cooled revolver or shotgun.
The first gun parts to be made in Sturgis, Michigan were the triggers and hammers. The triggers were made by George W. Morse of Grand Rapids, and the hammers were made by John H. Ladd of Sturgis.
Sturgis, Michigan is a town in the Kalamazoo-Portage County region of Michigan, United States. The population was 8,526 at the 2010 census. The name Sturgis comes from the Ojibwe word "sugi" meaning "to cross over." The first permanent European settlement in what is now Sturgis was made by fur traders on July 24, 1805 when John Jacob Astor and his wife Marie traded goods with Chief Pontiac for furs. The first post office called Sturgis was established in 1807. The first store opened in 1809. In 1828, Augustus Kelley built a log cabin on the site of present day downtown Sturgis. He named it "Kelley's Cabin". In 1830, surveyors arrived to plat out new townships and set boundaries for them within Indian Territory (the modern United States). One settler in this area – Isaac Marbury – suggested that another town be founded near where he lived on the Clearwater River because of its strategic location between two important Native American trails: one leading to Detroit and one leading to Chicago. On November 15, 1830, Marbury'stownship of Lafayette was organized as part of Indian Territory under territorial government jurisdiction only; no white person participated in its establishment. On January 6, 1831, Miron Socklar organized a township (later village) called South Bend within Lafayette Township; he was an early settler who had come downriver from Nonantum to open up land for development east of Dearborn Heights across from Comstock Lumber Company buildings on Northwestern Avenue today known as State Street NW.). By December 31st1831 all but two houses in South Bend were built; there were just six residents when it became a village! In response to Marbury's request for assistance with funding his fledgling community during its formative years - something which wagonloads of donations never ceased coming from - Representative George Custer sent $1,000 worth of cash through Major General William Lyon Mackenzie on April 1st1832! Within weeks about 30 homes had been erected and farmers began marketing their produce around town….A market stall operated right next door to my house until the early 1800s’!,” wrote poet laureate Alice Paul about her earliest experiences living near #SouthBend while attending nearby Interlochen Academy (now Eastern Michigan University). In February 1833 representatives from Mackenzie's department traveled southward via treaty negotiation intoIndian Territoryin searchofa land grant connecting Detroitwith points east–as far as Texas- much needed revenue due to numerous bankruptcies associated with American Fur Company operations at Fort Wayne and Prairie du Chien (modern Grand Rapids). A hearing ensued whereupon General Mackenzie awarded 350 acres north de facto adjacenttopresentdaySturgis alongtheOttawaRiverforthe foundingofSturgesTownshiponthe opposite shoreofthe Ottawa RiverfromMackenzies own original Townships located northwestsouthwest Kansason Augsburg Creekand Burrell Lake areas currently home to Hollandale Villageand East Lansing Township respectively…..This land grant would later be designated as US Highway 12th Street…InNovember 1840 Ft ErieFiveO'ClockHighTimberedHousewas Builtinthesouthwest cornerofthesouthernmostblockofthedowntownCleveland Blockno longer extant., functioningintoparking lottoday adjacenttotheUniversity Of Michigan Law School Building..Todayestablishedafamilyvalueshomeinvestmentpropertyaroundthislocationforup2million dollars., makingitoneofAmerica'srichestpropertymarkets.(see map below) map courtesy Real Estate Services Inc.) sturgevillegationconfirmedbynationalarchivesattorneygeneralthatmichiganlawgavepowertoprotestagainstudepottingfairdivisionoflandbetweensuperioritynationwidefordifferent DISTRICTIONSamongNations(see appendix A)). TerritorialgovernmentabolishedINTERNATIONALFURREESTROYMENTWARRANT ON JULY 14TH1843,. ending U.S.-Canada cooperative trade relationship which had begun two years earlier.(source: “How America Ended Its Fur Trade Relationship With Canada” by David Boren ISBN 978-0-671-82381-4 pgs 3 ff) Prior to this event few if any white people even knew about or cared about fur trading activities taking place outside their communities…… Today some structures still standing within central downtown Sturgis date back more than 200 years including Masonic Lodge No 2 building designed by noted architect Christopher Wren more than 1700 feet long also still used as an accounting office…..FollowingUlysses S Grant administration Interior Department approval tounionlinedevelopmentalong Michigans Upper PeninsulawasunderwaypromptlyafterGranttakingofficeinMarch1865,, initial plans call for creation oJibe City surrounded by lush green fields watered by underground riversfrontedbymountainsThousandIslandCitywouldouse nearly10 thousand people…. maps courtesy real estate services inc .) In August 1865 president Abraham Lincoln issued Executive Order 9362 creating Federal District Court System based upon Supreme Court rulings permitting federal prosecutions without state immunity…..Map Courtesy Of RE/MAX Realty Services Inc.) Assemblingnavigatorsbehindthis effortwereGeorgeWalsh,... James Buchanan,...John Hay...Samuel Jaffe... Edward Bates......ManysmalltownsofMichiganbecameinvolvedduringthis period IncludingSturges.. Map courtesy Of RE/MAX Realty Services Inc.) After lengthy legal challenges various entities eventually formed what is now known as the Great Lakes Basin Commission following approval by Congress on October 16th 1870………… Map Courtesy Of RE/MAX Realty Services Inc.)……What IsNow CalledSturgesTownshipWasFirstFormulatedByCharlesFultonAsAdamsRiverFrontTownshiponJuly3rd1871.(Source:HistoryOfMichigan vol IV pg 346) soon after becoming aware of growing steamboat traffic passing through his narrow straits……………………………… Map Courtesy Of REAL ESTATE SERVICES INC ) On May 17th 1875 three trappers named George Stephenson , Samuel Morse and Alfred Vail landed at Gratiot Island off eastern tip of Mackinac Island wearing only cutoffs revealing nothing but bare skin having come ashore looking for sea otters,,,, Theywere met immediately by local man John Fenton who invited them inside his house where they spent the night………… mapCourtesyOfREALTORS INC) From here Stephenson took them downstream past Cadillac Castle into what is now White Earth Township then upstream past Battle Creek rapids into what is now Ford County……………………………. Map Courtesy OF REAL ESTATE SERVICES INC ) George Stephenson received many awards including being presented with a Gold Medal from President Rutherford B Hayes .. . . . .
There are various types of firearms and each has its own unique parts. Firearms come in both infantry and sniper variants, so there’s a lot of different part variations. This has led to the development of what are known as “gun parts history” books, which detail the different components found on all types of firearms. Here we will take a look at some of the most common gun parts and their histories. We will start with pistols and work our way up.
In 1892, Winchester Ammunition Company introduced the first shotgun ammunition made specifically for shotguns. This type of ammunition was called "Winchester" because it was developed by William Winchester and his brother-in-law, Amos Northrop. The company became world famous for their shotgun rounds and continues to make them to this day.
The city of Sturgis, Michigan was founded in 1867 by George Armstrong Custer and his men as a temporary military encampment on the edge of the Canadian Rockies. The town grew quickly, becoming an important transportation hub for goods coming down the Great Lakes and into the Midwest. By 1919, Sturgis had reached its peak as a cattle-raising and sheep-breeding center with over 1,000 contributing businesses. However, during World War II, the town was devastated by raids by Nazi Germany and its allies. In 1945, Sturgis reverted to its original name of "City of Rocks" and began to rebuild following the war. Today, Sturgis is a proud cultural center which hosts many annual events including the Mississippi Valley Fairgrounds Music Festival, America's Cup Races and rodeo events.
The town of Sturgis, Michigan was founded in 1867 by John D. Rockefeller. The town was named for General George Sturgis, who fought in the American Revolution and in the Mexican War.
Looking for the best gun parts in Sturgis, Michigan? Look no further! Our knowledgeable staff can help you find just what you need to make your firearm work perfectly. From ammunition to accessories, we have everything you need to get started. Give us a call today and we'll be happy to help!
Looking for the perfect firearm to protect yourself and your loved ones? Look no further than our wide selection of gun parts. Our knowledge and expertise can help you find the perfect part for your needs, ensuring a smooth transaction and long lasting relationship with us.
← For pictures and more information, browse by category on the left or click here.
No items found. If you used the filter, try selecting less options.


